DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CD209

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:140 Identity:38/140 - (27%)
Similarity:70/140 - (50%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..::.....||.:|..:.|||.:..:|:::||:|:|:.:.|::    .||:   |..::| :.
Human   256 CPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQ----NFLQ---LQSSRS-NR 312

  Fly    89 SVWAGINCLGNRRTFLLARNGETVPYLN--WVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQ 151
            ..|.|::.|....|:........:|...  |...||||.. ||||..|:..    |::|.:|.:.
Human   313 FTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVG-EEDCAEFSGN----GWNDDKCNLA 372

  Fly   152 FPYVCQREPA 161
            ..::|::..|
Human   373 KFWICKKSAA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 36/134 (27%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
GumC <53..>225 CDD:442439
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 37/135 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.