DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Colec10

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:124 Identity:30/124 - (24%)
Similarity:53/124 - (42%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLG 98
            |.|::..:|.|:..:...||..|..|.:..::....|...::...|.       ..|:.|:|.|.
  Rat   158 KFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGF-------FRVFIGVNDLE 215

  Fly    99 NRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQ 157
            ....::...|.....|.||...||::....||||...: :|.  ::|.||.:...:||:
  Rat   216 KEGQYVFTDNTPLQNYSNWKEGEPSDPYGHEDCVEMLS-SGR--WNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 29/122 (24%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.