DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4a2

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001005880.1 Gene:Clec4a2 / 297584 RGDID:1359163 Length:235 Species:Rattus norvegicus


Alignment Length:146 Identity:41/146 - (28%)
Similarity:60/146 - (41%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSL-QEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLK-----SMGLSF 82
            |...:...|:.||..|. .:|.|..:...|.::||.|:|:.:|:::....|.|.     .:||| 
  Rat   107 CLKDWKSFGSYCYFTSTDSKATWDESKEKCSRMGAHLLVIHSQDEQDFINTILNIGTDYFIGLS- 170

  Fly    83 TQSWHHS--VWAGINCLGNRRTFLLARNGETVPYLN----WVPLEPNNASPEEDCVGFANYNGAF 141
                .||  .|..|               :..||..    |...||||  .||.|| ..|:...:
  Rat   171 ----DHSENQWQWI---------------DQTPYNESVTFWHKGEPNN--KEEKCV-VINHRDKW 213

  Fly   142 GYHDIECKVQFPYVCQ 157
            |::||.|..:...|||
  Rat   214 GWNDIPCHDRHKSVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 39/144 (27%)
Clec4a2NP_001005880.1 CLECT_DC-SIGN_like 107..229 CDD:153060 39/144 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.