DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4m

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:133 Identity:41/133 - (30%)
Similarity:70/133 - (52%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..::.:...||.:|..:.||:.|.|:|::..|:|:::::.|::    |||:     .|.....
  Rat   206 CPWDWTFLLGNCYFLSKSQRNWNDAVRACKEEKAQLVIINSDEEQ----TFLQ-----LTSKAKG 261

  Fly    89 SVWAGINCLGNRRTFLLARNGETV-----PYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIEC 148
            ..|.|::.|.|..|:|.. :|.|:     .|  |...||||.. |||||.||    ..|::|.:|
  Rat   262 PTWMGLSDLKNEATWLWV-DGSTLSSRFQKY--WNRGEPNNIG-EEDCVEFA----GDGWNDSKC 318

  Fly   149 KVQ 151
            :::
  Rat   319 ELK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 41/133 (31%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.