DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4a1

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_955015.1 Gene:Clec4a1 / 269799 MGIID:3036291 Length:245 Species:Mus musculus


Alignment Length:151 Identity:34/151 - (22%)
Similarity:58/151 - (38%) Gaps:38/151 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS-----MGLSFT 83
            ||..:....:.||..|...|:|..::..|...||.|:|:.:||::...|..|..     :|||..
Mouse   114 CPKNWKPFDSHCYFTSRDTASWSKSEEKCSLRGAHLLVIQSQEEQDFITNTLNPRAAYYVGLSDP 178

  Fly    84 QSWHHSVWAGINCLGNRRTFLLARNGETVPY----LNWVPLEPNNASPEEDCVGFANYNGAFGY- 143
            :.  |..|..:               :..||    .:|...||:..:  |.||..:.:....|: 
Mouse   179 KG--HGQWQWV---------------DQTPYDQNATSWHSDEPSGNT--EFCVVLSYHPNVKGWG 224

  Fly   144 ---------HDIECKVQFPYV 155
                     |.:.|:::..||
Mouse   225 WSVAPCDGDHRLICEMRQLYV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/151 (23%)
Clec4a1NP_955015.1 CLECT_DC-SIGN_like 114..240 CDD:153060 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.