DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4E

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:163 Identity:37/163 - (22%)
Similarity:65/163 - (39%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LECAN------AQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTF 74
            |.|.|      ...|||.:....:.||..|....:|.::.::|..:||.|:|:::||::..    
Human    66 LSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEF---- 126

  Fly    75 LKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVP-YLNWV---PL----------EPNNA 125
                 ||:.:.             ..|.|.:..:.:.|. ...||   ||          ||||.
Human   127 -----LSYKKP-------------KMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNI 173

  Fly   126 SPEEDCVGFA-NYNGAFGYHDIECKVQFPYVCQ 157
            :..|||.... :.|....::|:.|.:.:..:|:
Human   174 ATLEDCATMRDSSNPRQNWNDVTCFLNYFRICE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/147 (22%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 34/149 (23%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150844
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.