DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Reg1a

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_036773.1 Gene:Reg1a / 24714 RGDID:3552 Length:165 Species:Rattus norvegicus


Alignment Length:164 Identity:39/164 - (23%)
Similarity:68/164 - (41%) Gaps:23/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FLLIALILECANAQ-------------TCPLPFSRVGNKCYHVSLQEANWHVADRSCRKL--GAE 58
            |:|::.::..:.:|             |||...:...:.||:......:|..||..|:.:  |..
  Rat     7 FILLSCLMVLSPSQGQEAEEDLPSARITCPEGSNAYSSYCYYFMEDHLSWAEADLFCQNMNSGYL 71

  Fly    59 LMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPN 123
            :.||...|...| .:.:|..|.:..     :||.|::...|.|.:..: :|....|.:|....||
  Rat    72 VSVLSQAEGNFL-ASLIKESGTTAA-----NVWIGLHDPKNNRRWHWS-SGSLFLYKSWDTGYPN 129

  Fly   124 NASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQ 157
            | |....||...:.:|...:.|..|..|..:||:
  Rat   130 N-SNRGYCVSVTSNSGYKKWRDNSCDAQLSFVCK 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/134 (25%)
Reg1aNP_036773.1 CLECT 35..163 CDD:295302 35/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.