DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd207

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:140 Identity:31/140 - (22%)
Similarity:47/140 - (33%) Gaps:42/140 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHVSLQEANWHVADRSCRKLGAEL-MVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGN 99
            |:.|.....|:.|::.|....|.| .|....|.|.|   :..:.|:..        |.|:...|:
Mouse   210 YYFSRTPKTWYSAEQFCISRKAHLTSVSSESEQKFL---YKAADGIPH--------WIGLTKAGS 263

  Fly   100 R----------------RTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIEC 148
            .                |.|             |:|.|||||...|.|... ..:....::|..|
Mouse   264 EGDWYWVDQTSFNKEQSRRF-------------WIPGEPNNAGNNEHCANI-RVSALKCWNDGPC 314

  Fly   149 KVQFPYVCQR 158
            ...|.::|:|
Mouse   315 DNTFLFICKR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 29/137 (21%)
Cd207NP_659192.2 COG4372 65..>196 CDD:443500
CLECT_DC-SIGN_like 201..324 CDD:153060 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.