DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Mbl1

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:132 Identity:31/132 - (23%)
Similarity:47/132 - (35%) Gaps:32/132 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSV 90
            :|||:|                 ...|.:|...:.:..|.|:........|:           |.
  Rat   136 MPFSKV-----------------KALCSELRGTVAIPRNAEENKAIQEVAKT-----------SA 172

  Fly    91 WAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYV 155
            :.||........|:....|. :.|.||...|||:....||||...: ||.  ::||.|:.....|
  Rat   173 FLGITDEVTEGQFMYVTGGR-LTYSNWKKDEPNDHGSGEDCVTIVD-NGL--WNDISCQASHTAV 233

  Fly   156 CQ 157
            |:
  Rat   234 CE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/130 (23%)
Mbl1NP_036731.2 Collagen <36..86 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 31/132 (23%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.