DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Asgr1

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:141 Identity:31/141 - (21%)
Similarity:58/141 - (41%) Gaps:19/141 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||:.:......||..|.....|..||:.|:...|.|:|:.:.|::......:..:          
  Rat   153 CPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPL---------- 207

  Fly    89 SVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN-----ASPEEDCVGFANYNGAFGYHDIEC 148
            :.|.|:........::...:.|| .:.||.|.:|::     ....|||..|.. :|  .::|..|
  Rat   208 NTWIGLTDQNGPWKWVDGTDYET-GFKNWRPGQPDDWYGHGLGGGEDCAHFTT-DG--HWNDDVC 268

  Fly   149 KVQFPYVCQRE 159
            :..:.:||:.|
  Rat   269 RRPYRWVCETE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 29/137 (21%)
Asgr1NP_036635.1 Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859
CLECT_DC-SIGN_like 153..278 CDD:153060 30/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.