DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Reg3g

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_035390.1 Gene:Reg3g / 19695 MGIID:109406 Length:174 Species:Mus musculus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:69/147 - (46%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRK--LGAELMVLDNQEDKLLTTTFLKSMGLS 81
            ::..:||......|:.||.:.....||:.||.:|:|  .|..:.||...|     .:||.||..|
Mouse    35 SSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAE-----ASFLSSMIKS 94

  Fly    82 FTQSWHHSVWAGIN--CLG---NRRTFLLARNGETVPYLNWVPLEPN-NASPEEDCVGFANYNGA 140
            ...|..: ||.|::  .||   ||..:..: |.:.:.|:||   |.| ::|....|...:..:|.
Mouse    95 SGNSGQY-VWIGLHDPTLGYEPNRGGWEWS-NADVMNYINW---ETNPSSSSGNHCGTLSRASGF 154

  Fly   141 FGYHDIECKVQFPYVCQ 157
            ..:.:..|.::.||||:
Mouse   155 LKWRENYCNLELPYVCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 41/140 (29%)
Reg3gNP_035390.1 CLECT_REG-1_like 40..172 CDD:153064 42/142 (30%)
EPN. /evidence=ECO:0000250 114..116 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.