DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Reg2

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_033069.1 Gene:Reg2 / 19693 MGIID:97896 Length:173 Species:Mus musculus


Alignment Length:136 Identity:31/136 - (22%)
Similarity:59/136 - (43%) Gaps:10/136 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGA-ELMVLDNQEDKLLTTTFLKSMGLSFTQSWH 87
            ||...:..|:.||::......|..||..|:.:.| .|:.:.:|.:.....:.:|..|.:.:    
Mouse    43 CPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTAS---- 103

  Fly    88 HSVWAGI-NCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQ 151
             :||.|: :...|||...  .:|....:.:|....|:.|: ...||...:......:.|..|:.|
Mouse   104 -NVWTGLHDPKSNRRWHW--SSGSLFLFKSWATGAPSTAN-RGYCVSLTSNTAYKKWKDENCEAQ 164

  Fly   152 FPYVCQ 157
            :.:||:
Mouse   165 YSFVCK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/134 (22%)
Reg2NP_033069.1 CLECT 43..171 CDD:295302 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11568
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.