DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-195

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_503021.2 Gene:clec-195 / 191002 WormBaseID:WBGene00013798 Length:284 Species:Caenorhabditis elegans


Alignment Length:89 Identity:19/89 - (21%)
Similarity:33/89 - (37%) Gaps:31/89 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 WAGI------NCLGNR----RTFLLARNG---ETVPYLNWVPLEPNNASPEEDC----------- 131
            |.||      :|..|.    :.|:.: :|   :|...|:.:..:|...:.::||           
 Worm   199 WDGIWINGMRDCSANTNKTCQNFVWS-DGYTTDTELLLSGILWDPGYDTQQQDCLTVYNAYSDTK 262

  Fly   132 ---VGFANYNGAFGYHDIECKVQF 152
               |....||.|.|   :.|..:|
 Worm   263 LNLVSCTEYNLAIG---VACGYKF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 19/89 (21%)
clec-195NP_503021.2 CW 22..106 CDD:214742
CLECT 132..275 CDD:214480 15/76 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.