Sequence 1: | NP_001097145.1 | Gene: | lectin-33A / 53516 | FlyBaseID: | FBgn0040096 | Length: | 177 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507286.3 | Gene: | clec-238 / 190841 | WormBaseID: | WBGene00013622 | Length: | 222 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 44/202 - (21%) |
---|---|---|---|
Similarity: | 62/202 - (30%) | Gaps: | 62/202 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 FLLIALILECANAQ---------------------TCPLP-------FSR-VGNKCYHVSLQEAN 44
Fly 45 WHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNG 109
Fly 110 ET-----VPYLNWV--------------PLEPNNASPEEDCVGFANYNGAFGYHDIEC-KVQF-P 153
Fly 154 YVCQREP 160 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-33A | NP_001097145.1 | CLECT | 24..157 | CDD:214480 | 36/161 (22%) |
clec-238 | NP_507286.3 | CLECT | 72..217 | CDD:214480 | 33/156 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |