DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-111

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001355369.1 Gene:clec-111 / 190575 WormBaseID:WBGene00013502 Length:287 Species:Caenorhabditis elegans


Alignment Length:191 Identity:44/191 - (23%)
Similarity:65/191 - (34%) Gaps:61/191 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCIKGSFGFLLIALILEC------------ANAQTCPLPFS--------RVGNKCYHVSLQEANW 45
            :||...||.:.....||.            ||:..|.....        ::.|..|..|:.: .|
 Worm    45 VCIVFEFGQISTLQQLEASSGKVMGVKMLSANSTNCSTTSDGNSMVTGYQLNNTFYPYSISD-TW 108

  Fly    46 HV---ADRSC--------RKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQ--SWHHSVWAGINCL 97
            ..   :..||        |.||:..:.:      :.|||.|.... |.||  |.:..|.:|:..|
 Worm   109 TFTSGSSVSCQANFTMFVRPLGSWCIGI------IPTTTCLTQQD-SATQCKSLYGGVLSGLQTL 166

  Fly    98 GNRRTFLLARNGETVPYLNWVPLEPN--------NASPEEDC---VGFANYNGA--FGYHD 145
            . .|.|:.|   ...|   |:.|:.|        |.:.:..|   |...:.||.  |.|.|
 Worm   167 A-ERDFVAA---TAQP---WLGLQSNFTTYGVWINGARKTSCMETVKSVDCNGTNEFAYSD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 36/156 (23%)
clec-111NP_001355369.1 PAN_3 1..72 CDD:336982 6/26 (23%)
CLECT 132..267 CDD:153057 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.