DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-4

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_496688.1 Gene:clec-4 / 189654 WormBaseID:WBGene00012583 Length:425 Species:Caenorhabditis elegans


Alignment Length:200 Identity:38/200 - (19%)
Similarity:66/200 - (33%) Gaps:72/200 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTF 74
            ||:..|.|.:....|...|:.:..||..:.:..:....|:::|:..||.|:.:.|..|......|
 Worm    13 LLLLTISEASYPPVCTSGFTLINGKCLRIFVDVSTHTAAEKTCKGYGATLVTVKNSIDNRAIADF 77

  Fly    75 ------LKSMGL-----------------------SFTQSWHH----------------SVWAGI 94
                  |..|||                       :|...:.|                .:|...
 Worm    78 TGNNANLFWMGLYCFDSDVSKCLWDDATGSAEVYDNFAAGFPHIALGNCVYYSVQGALAGMWLSS 142

  Fly    95 NCLGNRRTF---LLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNG-AFGYHD-IECKVQFPY 154
            :| .:||:|   |.|.:.:..||                     |||| .:.:|: .....:...
 Worm   143 DC-NDRRSFICELPASHADPCPY---------------------NYNGFCYTFHNTASTYTKGQK 185

  Fly   155 VCQRE 159
            :|::|
 Worm   186 ICEQE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 32/182 (18%)
clec-4NP_496688.1 CLECT 27..153 CDD:214480 23/126 (18%)
CLECT 162..283 CDD:214480 8/49 (16%)
CUB 309..415 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.