DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-40

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_507252.3 Gene:clec-40 / 188627 WormBaseID:WBGene00011853 Length:386 Species:Caenorhabditis elegans


Alignment Length:138 Identity:35/138 - (25%)
Similarity:58/138 - (42%) Gaps:16/138 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            |...|..:..||..::....:...|:.:|.:|||.|:.:.:.|:.....:||....:|       
 Worm   127 CTNNFVLIDEKCLQLNTTLYSKPTAEATCNRLGATLLTIQSSEENQKIQSFLSIHQIS------- 184

  Fly    89 SVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEED---CVGF-ANYNGAFGYHDIECK 149
            .:|.|:.|.|...|.....||..|.|.::.|..||     .|   ||.: ..:|....:..:.|.
 Worm   185 QIWLGLICNGKSVTSCQWDNGSNVTYYDFAPGFPN-----VDTGICVSYNITHNSIGQWESLVCY 244

  Fly   150 VQFPYVCQ 157
            .|.|:||:
 Worm   245 KQLPFVCE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/136 (25%)
clec-40NP_507252.3 CLECT 127..252 CDD:214480 34/136 (25%)
CLECT 265..378 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I8088
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.