DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and F52E1.2

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:155 Identity:36/155 - (23%)
Similarity:64/155 - (41%) Gaps:20/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDN-QEDKLLTTTFLK 76
            |::::|...  ||..:..:.:|||........:..|..:|...||||:.:|: .|:..|...|..
 Worm    57 AMLIDCPGG--CPTGWQYLNSKCYKKFDAAVTYAGATSACAAQGAELVTIDSFDENDALRKAFDT 119

  Fly    77 SMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN----ASPEEDCVGFANY 137
            :..:..|:    ..|.|:..|.....:   .:|.:..|.||.|.:|::    .....|.:..|.|
 Worm   120 NALVDETK----ETWIGLKSLSGAWQW---ADGSSATYTNWAPSQPSSNGLCVQMITDSLSNATY 177

  Fly   138 ---NGAFGYHDIEC-KVQFPYVCQR 158
               .|  |:....| |....|:|::
 Worm   178 KYQRG--GWKTYGCGKTSASYICEK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 33/141 (23%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161729
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.