DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-45

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_504977.1 Gene:clec-45 / 184130 WormBaseID:WBGene00017199 Length:155 Species:Caenorhabditis elegans


Alignment Length:157 Identity:34/157 - (21%)
Similarity:63/157 - (40%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGFLLIALILECANAQTCPLPFSRV--GNKCYHVSLQEANWHVADRSCRKLGAELMVLDN--QED 67
            |...|:|.:|....|..||..|:|:  ..:|..:.:...::..|...|:.|||:::.:.|  |.:
 Worm     5 FSIFLLAFLLAPVAAIPCPTGFTRLVTTGQCLKMIVAPLSYSDASAKCKSLGAKVLTIQNAIQNN 69

  Fly    68 KLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCV 132
            .:|:.....:.|..      ...|.|:.|.....:.....:|....:..:...:|||:.  ..||
 Worm    70 AVLSFATASATGND------KDYWLGLQCTTASSSSCNWADGSKFSFDGFAEGQPNNSL--GTCV 126

  Fly   133 GFANYNGAFG-YHDIEC-KVQFPYVCQ 157
            ...|.....| :...|| .|:...:|:
 Worm   127 FVGNRGQTAGQWFSAECGLVKTNVICE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 28/138 (20%)
clec-45NP_504977.1 CLECT 22..153 CDD:214480 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.