DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-198

DIOPT Version :10

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_503091.3 Gene:clec-198 / 183598 WormBaseID:WBGene00008203 Length:499 Species:Caenorhabditis elegans


Alignment Length:112 Identity:28/112 - (25%)
Similarity:51/112 - (45%) Gaps:19/112 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SRVGNKCYHVSLQEANWHVADRSC--RKLGAELMVLDNQ-EDKLLTTTFLKSMGLSFTQSWHHSV 90
            |.|...||.::..:..|:.|:..|  ::.|:.|..:.:: |.:.:..|::.:....:..:|    
 Worm    92 STVNGMCYKIATADTTWYAAEDWCYSQRYGSHLTSVHSEAEAQWIAATYVSTGWFPYMDNW---- 152

  Fly    91 WAGINCLGNRR-----TFLLARNGETVPYLNWVPLEPNNASPEEDCV 132
                  ||.||     |::.. :|..|.||.|.|..|.:..||:.||
 Worm   153 ------LGLRRSCDNSTYIWT-DGTPVDYLWWQPGYPGSGDPEKSCV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 28/112 (25%)
clec-198NP_503091.3 CLECT 85..198 CDD:214480 28/112 (25%)
CLECT 371..497 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.