DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-266

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001024428.1 Gene:clec-266 / 180932 WormBaseID:WBGene00016088 Length:248 Species:Caenorhabditis elegans


Alignment Length:168 Identity:37/168 - (22%)
Similarity:68/168 - (40%) Gaps:35/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQED-----KLLTTTFLKSMGL-- 80
            |||..:.|..:.||.:...:.::..|::.|.:..|.|.|:::|::     :....|....:||  
 Worm    93 TCPDGWVRFSDSCYWIEQHKQSFAEAEKRCYEKNATLFVVNSQDEWDAVREHFPQTGYTWIGLVR 157

  Fly    81 --SFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWV--PLEP--NNASPEEDCVGFANYNG 139
              .|.:|....:|.....:...|             |||:  |.:|  |..|...:|.  |:::.
 Worm   158 FTHFEKSQDAPIWQTEGAVNPTR-------------LNWLIRPYKPVSNGWSALANCA--AHFSA 207

  Fly   140 AFGY------HDIECKVQFPYVCQRE-PAEDYLCLKRD 170
            |..:      :...|..:|..:|:|. ...|:|..|.|
 Worm   208 AINWDASAYTYFQPCSFKFYSICERNGTILDFLNRKFD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/151 (20%)
clec-266NP_001024428.1 CLECT 94..231 CDD:214480 30/151 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.