DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-109

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001252096.1 Gene:clec-109 / 173183 WormBaseID:WBGene00008907 Length:239 Species:Caenorhabditis elegans


Alignment Length:85 Identity:22/85 - (25%)
Similarity:34/85 - (40%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QTCP---LPFSR-VGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSF 82
            :|||   :.|.| .|..|............|:..|..:||.|..|.|..:::..:..|:  ||.:
 Worm    69 RTCPRDWITFERPQGRWCMKAFYGNMFQPEAEAKCNAVGARLSGLQNANERMTISYVLR--GLIY 131

  Fly    83 TQ-SWHHSVWAGINCLGNRR 101
            .. ...::.|.|    |.||
 Worm   132 QHGGGRYTAWLG----GKRR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 21/83 (25%)
clec-109NP_001252096.1 CLECT 71..>167 CDD:214480 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.