DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec-91

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_492448.1 Gene:clec-91 / 172736 WormBaseID:WBGene00014117 Length:225 Species:Caenorhabditis elegans


Alignment Length:153 Identity:37/153 - (24%)
Similarity:57/153 - (37%) Gaps:32/153 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..:.|..:.||.:..:...:..|:|.|....|.|.|.::.|:........:...||       
 Worm    78 CPDGWLRYSDSCYFIETESLGFAKAERKCHDKQATLFVANSMEEWDAVRDHAEKSVLS------- 135

  Fly    89 SVWAGINCLGN-RRTFLLAR---NGETVP-YLNWV--PLEP--NNASPEEDC---------VGFA 135
              |.|:....: .|...|.|   .|...| .:||:  |.:|  |..|...:|         |..|
 Worm   136 --WIGLVRFSHYERLEQLPRWQTTGSINPSKINWLIKPFKPVVNGWSSYANCAASFQSPTEVESA 198

  Fly   136 NYNGAFGYHDIECKVQFPYVCQR 158
            :|  .|.|   .|.:.|..:|:|
 Worm   199 SY--TFFY---PCTMAFKSICER 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/150 (23%)
clec-91NP_492448.1 CLECT 78..215 CDD:214480 35/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.