DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-33A and Mbl1

DIOPT Version :9

Sequence 1:	NP_001097145.1	Gene:	lectin-33A / 53516	FlyBaseID:	FBgn0040096	Length:	177	Species:	Drosophila melanogaster
Sequence 2:	NP_034905.1	Gene:	Mbl1 / 17194	MGIID:	96923	Length:	239	Species:	Mus musculus

Alignment Length:	132	Identity:	35/132 - (26%)
Similarity:	53/132 - (40%)	Gaps:	32/132 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 LPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSV 90
            :|||:|.:.|  ..||              |...:..:.:|:|.:...   :.|::|
Mouse   137 MPFSKVKSLC--TELQ--------------GTVAIPRNAEENKAIQEV---ATGIAF-------- 174

  Fly    91 WAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYV 155
             .||........|:....|. :.|.||...||||....||||...: ||.  ::||.|:..|..|
Mouse   175 -LGITDEATEGQFMYVTGGR-LTYSNWKKDEPNNHGSGEDCVIILD-NGL--WNDISCQASFKAV 234

  Fly   156 CQ 157
            |:
Mouse   235 CE 236

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-33A	NP_001097145.1	CLECT	24..157	CDD:214480	34/130 (26%)
Mbl1	NP_034905.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	35..88
		Collagen	<37..89	CDD:189968
		CLECT_collectin_like	127..237	CDD:153061	35/132 (27%)
		Calcium-dependent carbohydrate binding. /evidence=ECO:0000250\|UniProtKB:P19999	203..211		4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910