DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Fcer2

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:155 Identity:43/155 - (27%)
Similarity:65/155 - (41%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALILECANA-QTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTT 73
            |.|.:::....| ..||..:.....|||:.......|..|..:|..|...|:.:.:|:::    .
  Rat   171 LWIEILMSKGTACNVCPKDWLHFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQ----D 231

  Fly    74 FLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCV---GFA 135
            || ...::..:|     |.|:..|.....|:.. :|..|.|.||.|.||||....||||   |..
  Rat   232 FL-MQHINKKES-----WIGLQDLNMEGEFVWP-DGSPVGYSNWSPGEPNNGGQGEDCVMMRGSG 289

  Fly   136 NYNGAF--GYHDIECKVQFPYVCQR 158
            .:|.||  .|.|       .:||::
  Rat   290 QWNDAFCRSYLD-------AWVCEQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 39/137 (28%)
Fcer2NP_001029096.1 RILP-like <60..170 CDD:304877
CLECT_DC-SIGN_like 186..306 CDD:153060 39/137 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.