DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd209a

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_573501.1 Gene:Cd209a / 170786 MGIID:2157942 Length:238 Species:Mus musculus


Alignment Length:139 Identity:32/139 - (23%)
Similarity:65/139 - (46%) Gaps:16/139 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSW 86
            ::||..::.....||..|:.:.:|:.:..:|..:||:|:|:.:.|::.......|..|.:     
Mouse   106 RSCPWDWTHFQGSCYFFSVAQKSWNDSATACHNVGAQLVVIKSDEEQNFLQQTSKKRGYT----- 165

  Fly    87 HHSVWAGINCLGNRRTFLLARNGE-TVPYLN-WVPLEPNNASPEEDCVGFANYNGAFGYHDIECK 149
                |.|:..:....|:....... |:.::. |...||||.. ||||..|.:    .|::|.:|.
Mouse   166 ----WMGLIDMSKESTWYWVDGSPLTLSFMKYWSKGEPNNLG-EEDCAEFRD----DGWNDTKCT 221

  Fly   150 VQFPYVCQR 158
            .:..::|::
Mouse   222 NKKFWICKK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/134 (23%)
Cd209aNP_573501.1 CLECT_DC-SIGN_like 108..230 CDD:153060 32/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.