DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd209d

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_570974.1 Gene:Cd209d / 170779 MGIID:2157947 Length:237 Species:Mus musculus


Alignment Length:177 Identity:46/177 - (25%)
Similarity:75/177 - (42%) Gaps:40/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFLLIALIL-------ECAN-----------------AQTCPLPFSRVGNKCYHVSLQEANWHVA 48
            |.|||.|||       |..|                 .|.|...::.....||..|..:.|||.:
Mouse    66 GLLLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFFNGSCYFFSKSQRNWHNS 130

  Fly    49 DRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVP 113
            ..:|::|||:|::::..|::    |||:.     |.......|.|::.:.|..|:.........|
Mouse   131 TTACQELGAQLVIIETDEEQ----TFLQQ-----TSKARGPTWMGLSDMHNEATWHWVDGSPLSP 186

  Fly   114 YLN--WVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
            ...  |...||||.. :|||   |.::|. |::|:.|.....::|::
Mouse   187 SFTRYWNRGEPNNVG-DEDC---AEFSGD-GWNDLSCDKLLFWICKK 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/134 (26%)
Cd209dNP_570974.1 CLECT_DC-SIGN_like 106..228 CDD:153060 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5415
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.