DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Cd209c

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:183 Identity:45/183 - (24%)
Similarity:79/183 - (43%) Gaps:51/183 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIALILECAN-----------------------------AQTCPLPFSRVGNKCYHVSLQEANW 45
            ||:|::::.:|                             .:.||..::.....||..|..:.||
Mouse    67 LLLAILVKVSNVAYSHGQEQAKKEKVYKEMTQLKSQINRLCRPCPWDWTVFQGNCYFFSKFQQNW 131

  Fly    46 HVADRSCRKLGAELMVL--DNQEDKLLTTTFLKS---MGLSFTQSWHHSVWAGINCLGNRRTFLL 105
            :.:..:||||.|:|:|:  |:::..|..|:..|.   ||||..:  |...|..::  |:...|..
Mouse   132 NDSVNACRKLDAQLVVIKSDDEQSFLQQTSKEKGYAWMGLSDLK--HEGRWHWVD--GSHLLFSF 192

  Fly   106 ARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR 158
            .:        .|...|||| ..||||   |.:.|. |::|..|.::..::|::
Mouse   193 MK--------YWNKGEPNN-EWEEDC---AEFRGD-GWNDAPCTIKKYWICKK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 40/137 (29%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 41/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.