DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4C

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001358319.1 Gene:CLEC4C / 170482 HGNCID:13258 Length:213 Species:Homo sapiens


Alignment Length:141 Identity:36/141 - (25%)
Similarity:61/141 - (43%) Gaps:23/141 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS-----MGLSFT 83
            ||.|::...:.||.:|....:|..:.::|..:||:|:|::.:|::......||.     :|||..
Human    83 CPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDP 147

  Fly    84 QSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGA--FGYHDI 146
            ....|..|..........||             |...||||.  :|.| ...|:..:  :|::||
Human   148 GGRRHWQWVDQTPYNENVTF-------------WHSGEPNNL--DERC-AIINFRSSEEWGWNDI 196

  Fly   147 ECKVQFPYVCQ 157
            .|.|....:|:
Human   197 HCHVPQKSICK 207

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/139 (25%)
CLEC4CNP_001358319.1 CLECT_DC-SIGN_like 83..208 CDD:153060 36/141 (26%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 184..186 1/1 (100%)