DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4F

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:95 Identity:22/95 - (23%)
Similarity:39/95 - (41%) Gaps:22/95 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINC 96
            |...|:.|..:.:||.|::.|...||.|..:.::|::    .||    :.||...::  |.|:..
Human   587 GGSLYYFSSVKKSWHEAEQFCVSQGAHLASVASKEEQ----AFL----VEFTSKVYY--WIGLTD 641

  Fly    97 LGNRRTFLLARNGETVPYLNWVPLEPNNAS 126
            .|...::            .|....|.||:
Human   642 RGTEGSW------------RWTDGTPFNAA 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 22/95 (23%)
CLEC4FXP_011530937.1 Lebercilin 374..556 CDD:292252
CLECT_DC-SIGN_like 581..>657 CDD:153060 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.