DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Fcer2a

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:150 Identity:39/150 - (26%)
Similarity:58/150 - (38%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSM 78
            ||.:......||..:.....|||:.......|..|..:|..|...|:.:.:|:::......:.. 
Mouse   180 LISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINK- 243

  Fly    79 GLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCV---GFANYNGA 140
                     ...|.|:..|.....|:.: :|..|.|.||.|.||||....||||   |...:|.|
Mouse   244 ---------KDSWIGLQDLNMEGEFVWS-DGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDA 298

  Fly   141 F--GYHDIECKVQFPYVCQR 158
            |  .|.|       .:||::
Mouse   299 FCRSYLD-------AWVCEQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 36/137 (26%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056
CLECT_DC-SIGN_like 190..310 CDD:153060 36/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.