DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CG43055

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:134 Identity:35/134 - (26%)
Similarity:65/134 - (48%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PFSRVGNKCYHVSLQ-EANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSV 90
            ||.::|:..|.:..: :.||:.|..:||::.|:|:..::::::.|...:|....:..|      .
  Fly    41 PFVKIGDSYYFIENKLDRNWYDAFEACRQMNADLVAFEDRKEQKLIYHYLVDNEMDTT------Y 99

  Fly    91 WAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGF--ANYNGAFGYHDIECKVQFP 153
            |.....|..:.:|:...||:.|....|...|||||..||.||.:  .:.....|.:|..|..:..
  Fly   100 WTAGTDLAEQDSFVWFSNGQPVASDLWCNNEPNNAKNEEHCVEYKPLHPEAKMGLNDRVCTFKTG 164

  Fly   154 YVCQ 157
            |:|:
  Fly   165 YICR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/132 (26%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.