DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and Clec4f

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:145 Identity:34/145 - (23%)
Similarity:60/145 - (41%) Gaps:26/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLG 98
            |.|:.|..:.:||.|:..|...||.|..:.:||::    .||    :..|.:..|  |.|:...|
  Rat   422 KFYYFSRDKKSWHEAENFCVSQGAHLASVTSQEEQ----AFL----VQITNAVDH--WIGLTDQG 476

  Fly    99 NRRTFLLARNGETVPYLN----WVPLEPNN----ASPEEDCVGFANYNGAFGYHDIECKVQFPYV 155
            ....:... :|....|:.    |...:|:|    ....||||.....     ::|:.|...:.:|
  Rat   477 TEGNWRWV-DGTPFDYVQSRRFWRKGQPDNWRHGNGEREDCVHLQRM-----WNDMACGTAYNWV 535

  Fly   156 CQREPAEDYLCLKRD 170
            |::  :.|:...:.|
  Rat   536 CKK--STDWSVARTD 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/130 (24%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008
CLECT_DC-SIGN_like 414..538 CDD:153060 32/131 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.