DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC110438235

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_021324868.1 Gene:LOC110438235 / 110438235 -ID:- Length:199 Species:Danio rerio


Alignment Length:162 Identity:37/162 - (22%)
Similarity:64/162 - (39%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PFSRVGNKCY-HVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSM--GLSFTQSWHH 88
            ||:   :.|| .::|....|..|...|...|.:|:.:....::......::::  |:|.....|.
Zfish     4 PFN---DYCYLLITLSMRRWADARSDCLNQGGDLLSITEPFEQGYIQAVIQNIPTGVSLWMGAHD 65

  Fly    89 SVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQFP 153
            .|..|    |...|     :|....|:||....|::.. .|||:.....:||  ::|..|:.:..
Zfish    66 QVTEG----GWTWT-----DGSPFRYINWAAGNPDDYY-GEDCLSILINSGA--WNDDNCENKRG 118

  Fly   154 YVCQRE-------PAED-----YLCLKRDLFL 173
            |:|:|.       |..|     |.|....:.|
Zfish   119 YICKRRGNTPKPPPPHDGFYTAYACQDSSMVL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/132 (23%)
LOC110438235XP_021324868.1 CLECT 8..123 CDD:153057 29/126 (23%)
Gal_Lectin 150..>174 CDD:307994 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.