DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-33A and CLEC10A

DIOPT Version :9

Sequence 1:	NP_001097145.1	Gene:	lectin-33A / 53516	FlyBaseID:	FBgn0040096	Length:	177	Species:	Drosophila melanogaster
Sequence 2:	XP_011521915.1	Gene:	CLEC10A / 10462	HGNCID:	16916	Length:	319	Species:	Homo sapiens

Alignment Length:	143	Identity:	31/143 - (21%)
Similarity:	62/143 - (43%)	Gaps:	27/143 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS----MGLSFTQ 84
            ||:.:....:.||..|....:|..|::.|:...|.|:|::::|::.....:|.|    ||||..:
Human   184 CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPE 248

  Fly    85 SWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNN-----ASPEEDCVGFANYNGAFGYH 144
                ..|..::           .......:.||.|.:|::     ....|||   |:::....::
Human   249 ----GAWKWVD-----------GTDYATGFQNWKPGQPDDWQGHGLGGGEDC---AHFHPDGRWN 295

  Fly   145 DIECKVQFPYVCQ 157
            |..|:..:.:||:
Human   296 DDVCQRPYHWVCE 308

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-33A	NP_001097145.1	CLECT	24..157	CDD:214480	30/141 (21%)
CLEC10A	XP_011521915.1	Lectin_N	18..170	CDD:281887
CLEC10A	XP_011521915.1	CLECT_DC-SIGN_like	184..308	CDD:153060	30/141 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165150828
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000024
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.840