DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-33A and LOC103911722

DIOPT Version :9

Sequence 1:	NP_001097145.1	Gene:	lectin-33A / 53516	FlyBaseID:	FBgn0040096	Length:	177	Species:	Drosophila melanogaster
Sequence 2:	XP_009303414.1	Gene:	LOC103911722 / 103911722	-ID:	-	Length:	674	Species:	Danio rerio

Alignment Length:	130	Identity:	31/130 - (23%)
Similarity:	54/130 - (41%)	Gaps:	50/130 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly    36 YHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNR 100
            |::|.::.:|..:.|.|::..|:|.::.:.|:|    |||:.:      ..::::|     :|.|
Zfish   571 YYISFEKKSWEDSRRDCQQRRADLAIIKSTEEK----TFLQKV------LQNNNLW-----VGWR 620

  Fly   101 RTFLLARNGETVPYLNWV----PLEPNNASPEEDCVGFANYNGAFGYHDIECKV-----QFPYVC 156
            :|     ||:     ||:    ||..|                .||...|.|.|     .|.|.|
Zfish   621 QT-----NGD-----NWIWIDDPLVAN----------------GFGSDSINCAVVSETKYFSYAC 659

Fly 157 156
Zfish 660 659

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-33A	NP_001097145.1	CLECT	24..157	CDD:214480	31/130 (24%)
LOC103911722	XP_009303414.1	COG1340	210..505	CDD:224259
LOC103911722	XP_009303414.1	CLECT_NK_receptors_like	562..669	CDD:153063	31/130 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1509611at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010