DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC103910168

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_021327446.1 Gene:LOC103910168 / 103910168 -ID:- Length:109 Species:Danio rerio


Alignment Length:125 Identity:30/125 - (24%)
Similarity:53/125 - (42%) Gaps:31/125 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARN 108
            ||..:.:.||..|.:|:::.::|.:...|:|:       |:.....||.|:.            :
Zfish     5 NWSESRQYCRDRGEDLLIIKSEEKQRRVTSFI-------TEKVKMPVWLGLT------------D 50

  Fly   109 GETVPYLNWV---PL--------EPNNASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQ 157
            .|....:.||   ||        ||.|....|||| |.|...:..::|:.|.:...::|:
Zfish    51 AEIEGNMTWVDNSPLNEGFWMRGEPTNNDGIEDCV-FMNAISSPNWNDVPCSILARFICE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 29/123 (24%)
LOC103910168XP_021327446.1 CLECT 2..109 CDD:321932 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585473
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.