DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and CLEC4M

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:140 Identity:40/140 - (28%)
Similarity:69/140 - (49%) Gaps:15/140 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..::.....||.:|..:.|||.:..:|:::.|:|:|:...|::    .||:   |..::|...
Human   268 CPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQ----NFLQ---LQTSRSNRF 325

  Fly    89 SVWAGINCLGNRRTFLLARNGETVPYLN--WVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQ 151
            | |.|::.|....|:.........|...  |...|||| |..|||   |.::|: |::|..|.|.
Human   326 S-WMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNN-SGNEDC---AEFSGS-GWNDNRCDVD 384

  Fly   152 FPYVCQREPA 161
            ..::|::..|
Human   385 NYWICKKPAA 394

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 38/134 (28%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71