powered by:
Protein Alignment lectin-33A and si:ch211-133n4.7
DIOPT Version :9
Sequence 1: | NP_001097145.1 |
Gene: | lectin-33A / 53516 |
FlyBaseID: | FBgn0040096 |
Length: | 177 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017207814.2 |
Gene: | si:ch211-133n4.7 / 101885926 |
ZFINID: | ZDB-GENE-060503-665 |
Length: | 208 |
Species: | Danio rerio |
Alignment Length: | 48 |
Identity: | 10/48 - (20%) |
Similarity: | 21/48 - (43%) |
Gaps: | 3/48 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 KCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLS 81
|.|..|..:..|..:...|...|.:|:.:.::.:: ....|::|.|
Zfish 161 KLYFFSSDKLTWSSSRAFCVSRGTDLVTITSRSEQ---ARHFKAVGCS 205
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-33A | NP_001097145.1 |
CLECT |
24..157 |
CDD:214480 |
10/48 (21%) |
si:ch211-133n4.7 | XP_017207814.2 |
Ly49 |
54..>124 |
CDD:312037 |
|
CLECT |
158..>195 |
CDD:321932 |
7/33 (21%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000024 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22802 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.