DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC101884526

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_009303560.1 Gene:LOC101884526 / 101884526 -ID:- Length:269 Species:Danio rerio


Alignment Length:134 Identity:36/134 - (26%)
Similarity:66/134 - (49%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GNKC-----YHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVW 91
            |.:|     |.:|.::.||..:.|.|::.||:|::::::|::....   :.:|:|      .|||
Zfish   149 GWRCNQSSLYFISSEKKNWTESRRDCKERGADLIIIESKEEQEFVE---REIGVS------DSVW 204

  Fly    92 AGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASP-EEDCVGFANYNGAFGYHDIECKVQFPYV 155
            .|:.......|:... ||.::....|...||:..|. :|||.    .|...|:.|..||..|.::
Zfish   205 IGLTDSELEGTWTWV-NGTSLSPGFWGAGEPSGTSTNDEDCA----VNLPLGFGDYPCKNTFKWI 264

  Fly   156 CQRE 159
            |:|:
Zfish   265 CERQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 34/130 (26%)
LOC101884526XP_009303560.1 CLECT_DC-SIGN_like 148..267 CDD:153060 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585474
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.