DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC101734545

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_031750858.1 Gene:LOC101734545 / 101734545 -ID:- Length:471 Species:Xenopus tropicalis


Alignment Length:144 Identity:33/144 - (22%)
Similarity:58/144 - (40%) Gaps:38/144 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHH 88
            ||..:.::|::||:.|.:......::.:||..||.|..|:..:|      .||.|....::|:  
 Frog   312 CPDVWEQIGDQCYYFSSESQYRLQSETACRSSGAVLAKLEESDD------ILKKMIAKSSRSY-- 368

  Fly    89 SVWAGINCL---GNRRTFLLARN-GETVPYLNWVPLEPN----NASPEEDCVGFANYNGAFGYHD 145
              |.|:..:   |....|..:.| .:|:..|      ||    .|:||....             
 Frog   369 --WIGLKKVEHQGQTNLFRWSDNSSQTLESL------PNQFCAKATPELKAE------------- 412

  Fly   146 IECKVQFPYVCQRE 159
             .|....|::||::
 Frog   413 -TCSKLLPWICQKK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/140 (22%)
LOC101734545XP_031750858.1 Smc <87..>306 CDD:224117
CLECT 312..424 CDD:413318 32/141 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.