DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-33A and LOC100537240

DIOPT Version :9

Sequence 1:	NP_001097145.1	Gene:	lectin-33A / 53516	FlyBaseID:	FBgn0040096	Length:	177	Species:	Drosophila melanogaster
Sequence 2:	XP_003197805.3	Gene:	LOC100537240 / 100537240	-ID:	-	Length:	308	Species:	Danio rerio

Alignment Length:	136	Identity:	34/136 - (25%)
Similarity:	55/136 - (40%)	Gaps:	41/136 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    38 VSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS---MGLSFTQSWHHSVWAGINCLGN 99
            :|.:|.:|..:.:.||..|.:|:::.::|.:...::.:|.   :|||.||:.....|
Zfish   199 MSTEEKSWSDSRQFCRNHGGDLVIIKSEEKQRFISSVVKDDSWIGLSDTQTEGTMKW-------- 255

  Fly   100 RRTFLLARNGETVPY--LN---WVPLEPNNASPEEDCVGFA-------NYNGAFGYHDIECKVQF 152
                        |.|  ||   |...|||||...||||...       |:|      |..|....
Zfish   256 ------------VDYSPLNQGFWASGEPNNAGVNEDCVELTPTRPVLNNWN------DEPCSRGK 302

  Fly   153 PYVCQR 158
            ..:|::
Zfish   303 KGICEK 308

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-33A	NP_001097145.1	CLECT	24..157	CDD:214480	33/133 (25%)
LOC100537240	XP_003197805.3	DUF4795	86..>193	CDD:292662
LOC100537240	XP_003197805.3	CLECT_DC-SIGN_like	196..308	CDD:153060	34/134 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1509611at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010