DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC100537194

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_017211404.1 Gene:LOC100537194 / 100537194 -ID:- Length:306 Species:Danio rerio


Alignment Length:136 Identity:31/136 - (22%)
Similarity:58/136 - (42%) Gaps:46/136 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLL 105
            :|.:|..:.:.||..||||:::.::..:.:.::.:|           ..||.|::          
Zfish   199 EEKSWSESRQFCRNRGAELVIIKSEVKQRVISSLVK-----------EDVWIGLS---------- 242

  Fly   106 ARNGETVPYLNWV---PL--------EPNN-ASPEEDCV------GFANYNGAFGYHDIECKVQF 152
              :.||...:.||   |:        |||| .|.:||||      |..|     .::|:.|..:.
Zfish   243 --DTETEGTMKWVDNSPMNQGFWARGEPNNYRSQDEDCVEVRISQGIPN-----NWNDLRCSDRR 300

  Fly   153 PYVCQR 158
            ..:|::
Zfish   301 KGICEK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 30/133 (23%)
LOC100537194XP_017211404.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.