DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec4m

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_017948020.2 Gene:clec4m / 100497637 XenbaseID:XB-GENE-6043650 Length:225 Species:Xenopus tropicalis


Alignment Length:162 Identity:32/162 - (19%)
Similarity:62/162 - (38%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKGSFGFLLIAL--ILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVL--D 63
            :|.:...|:..|  :.|.:....|...:......||:.|.....|:.|...|.|..::|.|:  :
 Frog    73 LKNNVSVLVYKLKQLEETSQRSNCDSGWKEFNGSCYYFSKSIMGWNKARALCLKKESDLAVITSE 137

  Fly    64 NQEDKLLTTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASPE 128
            |::|.|..||......:..:.:.....|..::           ....:..|..|...|||:....
 Frog   138 NEQDFLYETTQDDRYWIGLSDTDQEGAWVWVD-----------GTDYSTSYKFWKEGEPNDHLNN 191

  Fly   129 EDCVGFANYNGAFGYHDIECKVQFPY-VCQRE 159
            |||.....:.   .::|:.|...:.| :|:::
 Frog   192 EDCAHMWTHG---EWNDVPCSYSYCYAICEKK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 27/135 (20%)
clec4mXP_017948020.2 CLECT_DC-SIGN_like 96..219 CDD:153060 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.