DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and clec19a

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_002932255.2 Gene:clec19a / 100491258 XenbaseID:XB-GENE-6049079 Length:193 Species:Xenopus tropicalis


Alignment Length:157 Identity:40/157 - (25%)
Similarity:61/157 - (38%) Gaps:38/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TCPLPFSRVGNKCYHVSLQEANWHVADRSCRK--LG---AELMVLDNQEDKLLTTTFLKSMGLSF 82
            ||||.::.....||........|..||..|.:  ||   |:|:.:.:.::.:.....:.|.....
 Frog    46 TCPLFWTEYNGNCYRFFPMNKTWAEADFYCSEFSLGRTTAKLVSIHSWDENVFVFDLVNSQVTGV 110

  Fly    83 TQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPN--------------NASPE-EDCV 132
            ..    .:|.|   |.:||     :.||    ..|....||              |:||| ||||
 Frog   111 PT----DIWIG---LSDRR-----QEGE----FEWTDGTPNDYSYWDGNQPDDATNSSPEDEDCV 159

  Fly   133 --GFANYNGAFGYHDIECKVQFPYVCQ 157
              .:..|:....::|..|...||:||:
 Frog   160 QMWYRYYSALRSWNDNSCNRGFPFVCK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 38/154 (25%)
clec19aXP_002932255.2 CLECT_CEL-1_like 47..187 CDD:153059 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.