DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC100487836

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_017948017.1 Gene:LOC100487836 / 100487836 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:164 Identity:38/164 - (23%)
Similarity:72/164 - (43%) Gaps:37/164 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIALILECANA-------QTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDK 68
            |:..||:..||       :.||..:..||..||..|.:..:|..:.:.|:|||::|::..:|.:.
 Frog   241 LLTQILKLKNAIQKQGICKLCPPDWKLVGFNCYFFSKEPKSWADSRQQCQKLGSDLLIFTDQAEV 305

  Fly    69 LLTTTFLKS----MGL--SFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLNWVPLEPNNASP 127
            .....::::    :||  :..|.|:   |.               :|:.:.:..|...|||||..
 Frog   306 DALYQYMQNKRFWIGLQRNKDQKWN---WV---------------DGKALTFNRWGTGEPNNAGS 352

  Fly   128 EEDC-VGFANYNGAFGYHDIECKVQFPYVCQREP 160
            .|.| ...:.|     ::|::|.....::|:..|
 Frog   353 GEHCGETLSRY-----WNDLKCGDIIDFICEGPP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 31/139 (22%)
LOC100487836XP_017948017.1 EnvC 165..>257 CDD:227278 5/15 (33%)
CLECT_DC-SIGN_like 261..378 CDD:153060 31/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X59
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.