DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and LOC100486944

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_031754100.1 Gene:LOC100486944 / 100486944 -ID:- Length:418 Species:Xenopus tropicalis


Alignment Length:177 Identity:36/177 - (20%)
Similarity:73/177 - (41%) Gaps:33/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CIKGSFGFL---LIALILECANAQTCPLPFSRVGNKCYHVSLQEANWHVADRSCRKLGAELMVLD 63
            ||.|:...:   ::..|.:  ..:.|...:......||::.....||..|...|:.:.::|:::.
 Frog    12 CISGAMKSIKQDILQTIQK--EIRQCDSGWKSFDGSCYYIVTTMKNWTEARGFCKSMNSDLVIIK 74

  Fly    64 N-QEDKLL-TTTFLKSMGLSFTQSWHHSVWAGINCLGNRRTFLLARNGETVPYLN---WVPLEPN 123
            : :|.|.| ..|.:....:..|:..:.:||..::              .|:..|:   |...|||
 Frog    75 SAREQKFLENITSITKFWIGLTKDRNKNVWRWVD--------------GTLHNLSDGFWYEDEPN 125

  Fly   124 NASPEEDCVGFANYNGAFGYHDIECKVQFPYVCQR------EPAEDY 164
            |.:..||||   |......::|:.|...:..:|::      ..::||
 Frog   126 NEAGREDCV---NLWKDKKWNDVYCTGLYKAICRKGTRQSDSDSDDY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 29/137 (21%)
LOC100486944XP_031754100.1 CLECT_DC-SIGN_like 35..157 CDD:153060 30/138 (22%)
CLECT_DC-SIGN_like 289..412 CDD:153060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.