DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and si:ch211-232p21.6

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_021327532.1 Gene:si:ch211-232p21.6 / 100334411 ZFINID:ZDB-GENE-131121-178 Length:149 Species:Danio rerio


Alignment Length:142 Identity:36/142 - (25%)
Similarity:58/142 - (40%) Gaps:36/142 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VGNK--CYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS----------MGLSFT 83
            |.||  .|..|....:|..:.|.|:.||.:|:|:|:.|::    .||..          :|||.:
Zfish    23 VQNKGRLYVFSTDVMDWSSSRRRCQDLGGDLVVIDSTEEQ----EFLSKKVNGVHDFHWIGLSDS 83

  Fly    84 QSWHHSVWAGINCLGNRRTFLLARNGET---VPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHD 145
            |.  ..||..::     .|.|   |.:|   .|..:|   :..|....||||...:..    :.|
Zfish    84 QM--EGVWLWVD-----NTTL---NNDTSWDSPPDDW---KAENPLDGEDCVILKDRK----WGD 131

  Fly   146 IECKVQFPYVCQ 157
            :.|..:...:|:
Zfish   132 VSCLRKEKRICE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 35/140 (25%)
si:ch211-232p21.6XP_021327532.1 CLECT_DC-SIGN_like 26..143 CDD:153060 33/137 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.