DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and dcsignlg

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:136 Identity:33/136 - (24%)
Similarity:61/136 - (44%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS---MGLSFTQSWHHSVWAGINCL 97
            :.:|.:..:|..:.:.||..||:|:::.::|.:...::.:|.   :|||.|::.           
Zfish   150 FFMSTEAMSWSESRQFCRDRGADLVIIKSEEKQRFISSLVKEDTWIGLSVTETG----------- 203

  Fly    98 GNRRTFLLARNGETVPYLN---WVPLEPNN-ASPEEDCV------GFANYNGAFGYHDIECKVQF 152
            ||:..::     :..| ||   |...|||| ...:||||      |..|     .::|..|....
Zfish   204 GNKWKWV-----DNSP-LNQGFWAKGEPNNYQGAKEDCVEVRISQGTPN-----NWNDRRCSDSR 257

  Fly   153 PYVCQR 158
            ..||::
Zfish   258 KAVCEK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 32/133 (24%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066
Uso1_p115_C 78..>146 CDD:282695
CLECT_DC-SIGN_like 144..263 CDD:153060 33/134 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 1 1.000 - - FOG0000024
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.