DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-33A and si:ch211-160b11.4

DIOPT Version :9

Sequence 1:NP_001097145.1 Gene:lectin-33A / 53516 FlyBaseID:FBgn0040096 Length:177 Species:Drosophila melanogaster
Sequence 2:XP_021327879.1 Gene:si:ch211-160b11.4 / 100150558 ZFINID:ZDB-GENE-081104-142 Length:315 Species:Danio rerio


Alignment Length:135 Identity:37/135 - (27%)
Similarity:57/135 - (42%) Gaps:26/135 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VGNKCYHVSLQEANWHVADRSCRKLGAELMVLDNQEDKLLTTTFLKS--MGLSFTQSWHHSVWAG 93
            |.:.||....::.|...|:..|:| |.     .|.....:|::|:::  ..|....|.....|  
Zfish   194 VQHTCYEFFTRKLNASDAELQCQK-GC-----PNGHLASVTSSFIRAEIYNLMDRYSSRSDTW-- 250

  Fly    94 INCLGNRR-------TFLLARNGETVPYLNWVPLEPNNASPEEDCVGFANYNGAFGYHDIECKVQ 151
               ||.||       |:|   :||...|..:...||||....|||:... |.  .|::|:.|.:.
Zfish   251 ---LGGRRIIGTNTFTWL---DGEPWTYNGFFSGEPNNLGGNEDCIEIL-YR--VGFNDVACFLT 306

  Fly   152 FPYVC 156
            .|:||
Zfish   307 RPFVC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-33ANP_001097145.1 CLECT 24..157 CDD:214480 37/135 (27%)
si:ch211-160b11.4XP_021327879.1 CLECT 198..311 CDD:153057 34/129 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.